ELFp44 (444VVT `.aa /lib/ld-linux.so.2GNUap\&X2WVMIhm?@6CjTHd_be(lYkDcRSGB4n 'g<)Q+aP`>1L ^ioF*OJ$/"9%-;. 5 ,!EAN=KU[Z:8]3#f7 0 T;dtg@b5)=;"=uĔ*lԔ63p( >)$47-DTd$At70s. ĕ.k4ԕ:;$i48DZT:_d!t2")JDbRHbLbĖ7Ԗ#:B C$*44+DAT7d]t+&(ėԗF96;-$K4.D:Trd=t7Y :HRĘ2 hԘ;x"| *$*&4aD)cTd8t=Y;CPbk:J<]Xę".Tbs!ԙ)Q:QXb4$=47|Dr &T__gmon_start__libnsl.so.1libc.so.6strcpytextdomainioctlsiginterruptprintfstdoututimecfgetospeedconnectstrerrorgeteuidgetopt_long__ctype_bgetenv__strtol_internalfgetserror_at_linememcpytmpfilesetvbufexeclpclose__cxa_finalizedup2tcflushgetuidtcsendbreaksystemmallocsleepoptargtcdrainsettimeofdayopterrsocket__strtoul_internalerror_message_countfflushabortchmoderror_print_prognamealarmpopenacceptstrrchrwritefprintfdcgettextbindinet_addr__deregister_frame_infosetsockoptfseekoptindumaskmktimestrstrsignalreadopenlogunlink__strdup_IO_getclistensscanfgettimeofdaylocaltimememsetclearerrinet_ntoatcgetattrtimesyslogstrcmpgetpwuidgethostbynamegethostnamesprintffclosesetlocalestderrerrorfwrite__xstatrewind__errno_locationexit__fxstatbindtextdomainsetbuferror_one_per_linefopen_IO_putcfileno_IO_stdin_used__libc_start_mainstrlenstrchrfputsvasprintffcntltcsetattrmkdir__ctype_tolower__register_frame_infovfprintfstrpbrktcflowfreegetsocknameGLIBC_2.1.3GLIBC_2.1GLIBC_2.0si ii #ii -an@bDb,Hb-Lb.Pb^TbcXbi`` ````` ` $` (` ,` 0`4`8`<`@`D`H`L`P`T`X`\```d`h`l`p`t` x`!|`"`$`%`&`'`(`)`*`+`/`0`1`2`3`4`5`6`7`8`9`:`;`<`=`>`?`@`A`B`C`D`E`FaGaHaI aJaKaLaMaN aO$aQ(aR,aS0aT4aU8aVPj? j=Tb@j SWR;~jh&jPj  j$ pp$c9} Qcc)Ѓ ejh&jPAt& jPjjQ*{jۣctrt:t[oTb Sjh$jPh%Ot& Tb Qjh$jPh &$Tb Rjh$jPh`&jj{ cjh&jP?v,Wt 1=,W!WDW@DWjh 'j Pjj>{jh`'j Pjj{ 5TbjPjjVyË ۣ$_trt;t\Tb Sjho$jtPh%Ot& Tb Qjho$jIPh &$Tb Rjho$j#Ph`&jj=z $_ =jh'jP jPTbjjPxË ۣpXtrt>tijt&=Tb Wjh'jtPh%5Tb Vjh'jIPh &&Tb Sjh'a&1ɉ WvSZYhVu!jh1)jg PjjsSHbVh`)PHb^S<$|mZTWYjP5TW_XjVXW\Wj:SÃu!jh)j PjjrC \WSQh)SHb Sh)R=HbXWV$jm[TW^jPTWZYjPjj? h@h j=^_hPjujhPjhPjY[hPj XZWVu jojj?t@Wu jkoWt^=LbWh)tLbSjh) LbQjh)j1P8 RUEjP]Ít&'UVSuE HbtRtP Ph+LbSC Q jh+jPLbR4$=hc% P jh,jqPS5  V jh ,jLPSZYSjh`,j.P5^XSjh,jPZYSjh -jPEe[^]UcV1S] EEEEEEEEu E W(u- R jh>5jGPLbP t-u1 EP$tW xXtjj5؃]1hdSm=dtShd sM؃j/QƃtFt&u؃ EPq:WxXMjjQ5ɃـE@uh6M1ҋ]R)؃=WP,$XZ}ԋEE mԉE]mԋ]~,U SRQ jh`5jPLbP8 xXUSRfPVh5jjW =WƅHƅIE5w xXtjjh4؃EPHP ct Pg hcu!jh(j Pjjm3 cVQcZP%j/3Vƃ tF3LbSj ] c QR jh5jnPLbPLbSh)[cZYh5Piu)xXdPVh5ji EP=W xXjj2ɃـE@uh6MU)1RP,$XZ}ԋEE mԉE]mԡW]Ѕt&SQ jh6jbLbPRxXMSQcPVh5j3h xXt!cPu46Ph<6jh jh Wtt Pit P5WtDct; Pc SQ jhM6jtLbPR e[^]ÐUXWVHS E}u Xx0]0 ]j2 (Hb$1GRH҃CP HbXQ$z9|t&ukjhp6jP11 HbXZQjUHbZPI$)9XHX3 j297jdVSr5HbVj Hb[Q1e[^_]Ív'U (W1VS $uFtCUU썶HbWRPq Hb[Qd$D81U HPhdRÉ$Wƒ9uXF ׅtN‹E)9sUN NEFEPhdVB?%9u$jh6jPj/u> V+uMHbSjnHbYRa$A71$tjh6jkP.e[^_]ÐU1ɉW1VS &XHXx0@0E P/Ãu EUXHXx0@0U j/EXHXx0B0 jP/E=zEE 1UE:OxevXHXx0@0 j.Å6X1ЋU1؈BEOUyXHXx0@0 j.Åw=(6X11XHXx0@0t& j6.Å6X11ftjh61E5$E(؄u1ۋE$jh6jh6uKXHXx0@0t'& jv-u\t&u;=u"jh6juP,&v u$u2jh6t&Sjh6jP+1vKt4XHXx0@0 j,uƋ=$t.5(1HbSH҃CPlHbYRE(HbPjK5Hb_V>$3 @  jae[^_]UWVS}Wo EPRjÃu6xXe?_0V Ph6j_<]uE 9Et 1+t&]u']" 1% Z1Kt Wuփ W_ jjW1U RY_Xhj ;1]t&SjhIUtgt`L t7uB5WtJjh7jLbPS;$19&1~1Ne[^_]ÐU|XWVSt PF=4Wt}uj/VkƒtfB:u]Wt+MQ jh@7jLbPRxXg}Wh7j]LUu V@$|Xu!jh(j Pjj`] |XSQW|XU =W~_PcP jh7jPLbPR P jh7j$PLbP5(W51lt $Wttc $Wu<u1҉ t&<u =5t<u,Wt=cu=t 7l,t 7l5DW1=HWt%u7 8u HWPW1ɉ LWt$u78u LWM }A 5wAAAWuXhxtI EPEP|Ph7SAEU B|B EBBt=2 W$c$<<  HWLWEh7P$ct   P EPRjƃun=Wt+MQ jh7jLbPRxX Si}PWh8jQZ=cu1M A9E~[5xX]Sh 8jZp] C 9Er*C9E~" xXtSURh@8jY; PVu^U jz WPxÃu5 Vt&۸ ShJ PWc$<t9 WtUR jh7j%PLbP{} W2uÍC)ĉSV4;1W.FMdSChf8VdQWjt́|X RP<$@$O|Xu!jh(jB Pjja[|XWP|X] h8u |Xts jLLbY[Rh)  P jh9jP5LbVPLbY[Rh)Ee[^]tt&e[^]É'UW1VS E=ctQI @W1Hƃ%t& jEDW#t ct @tXhS'=TWu?=`Wt6 h`WHZTW`WYjPSTWY[jRC=tXu tXjjhx5I$:G:uy$,c tXEPh hd.XZjjgkx*v$@ cEPj h[.=k jCY[hjt&$CXZhjEPh hd-=k5WtLjh :j. LbPQh+R =LbhdPh+Wv 50Wuu Wt/jhC:j PLbRh+P3hjM%=xXhdhP:jH5xXthdha:jbHt j hd${B jt&'hj$ @ jjh2ut0 hdnhjZ$ Kwt& WtKjhs:jyLbPR%Wt$jh7jR=LbPWt&N7x 1e[^_]Ðt&UWVS &jj؋u_V8ǃ =WxXjjɃـE@u:UBJ1R)ȃ=WP,$XZ}EE mE]m~6U RUB PrV jh`5j-LbPS蝿 xXtQE460tUj/RÃuCEPEp VLAPSh5jE u} Wt$jh:j蟿LbPRxXtFU462t"Ej/8WÃut&C@PSh:jLE+1҃JZV5xXtGU462t#Ej/SÃu t&CZ@PSh:jDe[^_]ÍUWVSDEEEEEE@PhdEupxXtNU462t*Mj/9W]Ãu C?PSh;jD5tX t&E XS1>ZYhj CuP{WVCU BKQRh ;Xtm1v'MA9ts sBCPRh`;tC G C XK Q$1ۃt߉ujjh.ÍC w$>xXE468Uj/Pw&My`5xXM469t Ej/Q賿ƃuF ;t6P=PVh<,EPh hd&M h<U;Bt 1҉ E P< ti =tX5xXtGM461t#Ej/SÃu t&C:=PSh@<jA ha< h<M& xXU46:t+Mj/R~v'ƃuvF S<PVh;j8A 7E PD=xXtNE468t*Uj/2V ƃu FJ<PVh<j@ h<, t& h;M;AT h:My_ h<  xXtE460t"Uj/RUÃut&C;PSh<EPh hd$Ãkh{M;qo j蹺ÃtE܃ P褺Ct]{tVMQVh=j?U܃ RVh= E܃ Phd{W[3E܃CXC X SWhXucfhXt}}E̋MȋM9A9EEP1jɃـE@u>M1ҋARP,$XZ}EE mE}m]ۉ]t+y1ҋA )))MhXuą9UE؋M);lXRSjh@=j P| xXM461tEj/PÃuC=hXuWV,9PSh=j= E&9UsE؉Eġctn9E|ijh=jZP xXaU462tMj/RBÃuC8PSh==W~TEuPEWVX SHQ jh=jѶLbPRAE @EEtEȃEPh hd+!Ãhj(ot-et&jkb=jh>xX3U462t!Mj/9WÃuvCZ7PSh2>^MykSh;=xXE460tUj/ Q貸ÃuC6PShN>j|;t& h[MRxXtOM469t+Ej/P>ƃu'Fz6PVh>j:Sh;[Eu܃]VhdSE܋UJȉB$4^_hh=E]܃MShdQE܋MQЉA$4^_hjE]܃MShdQdE܋UBvEU܃ERhdP4E܋MALve[^_]Ð&UWVS u>>u;t&VsÅu Vq PVjeK9t؃)PVjM;u jKt& j t De[^_]ÍU WS]t! R葲ƒ1H8LWtr S  Qhh`W^u,jh?jV P蚲[ZQjj; R,v Pt1jh0?jP c[QرwSt' j荳EUCYEXcRP賵S%=u6EU=W~( _QURhWALbP蹒jhgAjPojh@ jhwAjPEEG6X11;}jhAj譒P@e[^_]ÍvUWVS EU 9EE5&'XHXx0@0=$_ W`u R McmkahU߉1ZX1HXx0@0 $_ Qa`u Ri_1ËZX1HXx0@0$_ P`u R1ËZX1HXx0@0 $_ Q`u R1ËZX1HXx0@0$_ S)`u R1'1Ӌ Z1= tjhOA&U)UUE)E E =W~(_LbP2VhASBt&jhgAj裏P6ujh@ vjhwAjsPHUB1U% ZE19jhAj,Pe[^_]ÉUpXW=W1V1S E50XHXx0@0$_ SÃt6* }~hXHXx0@0 jÃVX.&tku;%(Ou&jhAjP|M t `tWt LbP"} 5W LbQSUXHXx0@0t&$_ R…҉x)Bw $At&ct`tӃt ~u*tXHXx0@0$_ S…҉x'Bw$0B ct`tӃ#BtZ AtpCt%f} A01W$1BM C$CQ50-} B01W$ÃUMBRQЉEt  A|<t u-48_VjhAj蔋P'Cw"=W~;M8_LbQRhAP=W~}5LbWShAV迊MtUE؍e[^_] UXWVHS Xux0@0t&$_ R`u RX 1ِXHXx0@0$_ P2`u R:XF11OyXHXx0@0=$_ W`u RX11ءXHXx0@05$_ VP`u RXuZX11ft&jhOAj5P c @We[^_]É'UXWVHS X}x0@0t&$_ S`u RZ%Z'XHXx0@0 $_ Q`u R 1%ZG1Ny&XHXx0@0$_ P`u Ru_1%Syu!jhSEjz Pjjjj jS| fjjjfE~ÃyhDzZ0YVjh0jz$~E jPS[~yhqEtzZ0YVjD j~e[^]ÐUxXSE_ui_| Sytt8t P|_ _u!_ShyEh__}EPE PEPz] _USQh~ERizEP }]]ÐUS]S$_8{ Ph_S)xu h_{ Ph_jx]]ÐUEV1ҋ5XbSDbDbuR E jhEhEPj{ t0htvt$E jЃE j$|Dbe[5Xb^]ÐUWVS } u}lxEjuPWVD| Ƹ ;]Uu;&;PEPvB5$EE1҉RP,$XZEtv ]E1҉RP,$XZEtV =E1҉RP,$XZEt6E1҉RP,$XZEtCE01e[^_]ÐU8VuS] t,Hb R}v  LbPhFQvEUPLbRPw4t! StvLb PhFSu LbQj zLbZPut Vye[^]Ít&U<WVS } ]ut695cu"c9SP:uc5c8t. Hb Quu  LbRhFP utV5LbShFVt]EP LbSQv4t! WQuLb PhFRtLbPj x5Lb_Vt]tM Qxe[^_]ÐU_S_tv'ЋuX[]U]ÐUSQ[?vy]caught signal %d; exiting\%+V%aO%bG%B8%C"%C%e%E%h%H$j$$O$O$m$M$n$N$p$r$R$q$sw$So$t`$uU$UM$vB$w9$c2$X+$$$Z$y$D$$####tcp-clienttcp-servero_synco-syncdelay-startupsyslognulloverwritezmodemymodemxmodemwith-crcwindowsizeverboseunrestrictkeep-uppercasetimeouttimesyncstop-atquietrestrictedresumeprotectnewer-or-longernewermin-bps-timemin-bpsdisable-timeoutdisable-timeoutserrorsjunk-pathcrc-checkhelprenameescapeallow-remote-commandsallow-commandsbufsizebinaryasciiappend0.12.20lrzsz%s (%s) %s SHELLrshrkshrbashrshellZMODEM_RESTRICTED/usr/share/localea+bB:cCDeEhm:M:OprRqs:St:uUvw:XZyautokmmin_bpsinvalid %s `%s'invalid character following %s `%s'%s `%s' larger than maximum long intmin_bps_timemin_bps_time must be > 1hour to large (0..23)unparsable stop time minute to large (0..59)stop time to smalldon't have settimeofday, will not set time not running as root (this is good!), can not set time timeout out of range 10..1000window size--unrestrict option used under restricted shellsecurity violation: can't do that under restricted shell offnocannot turnoff syslogbytes_per_errorbytes-per-error should be >100startup delayout of memorythis program was never intended to be used setuid garbage on commandline%s %s hostname too long connect with lrz --tcp-client "%s:%s" illegal server address [%s] <%s> connecting to %s Transfer incomplete Transfer complete V  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGFVfGGGGGGGG5@GGGGGGGGGGН6GrGGGGGGנpեG%s: %s Try `%s --help' for more information. %s version %s Usage: %s [options] [filename.if.xmodem] Receive files with ZMODEM/YMODEM/XMODEM protocol (X) = option applies to XMODEM only (Y) = option applies to YMODEM only (Z) = option applies to ZMODEM only -+, --append append to existing files -a, --ascii ASCII transfer (change CR/LF to LF) -b, --binary binary transfer -B, --bufsize N buffer N bytes (N==auto: buffer whole file) -c, --with-crc Use 16 bit CRC (X) -C, --allow-remote-commands allow execution of remote commands (Z) -D, --null write all received data to /dev/null --delay-startup N sleep N seconds before doing anything -e, --escape Escape control characters (Z) -E, --rename rename any files already existing --errors N generate CRC error every N bytes (debugging) -h, --help Help, print this usage message -m, --min-bps N stop transmission if BPS below N -M, --min-bps-time N for at least N seconds (default: 120) -O, --disable-timeouts disable timeout code, wait forever for data --o-sync open output file(s) in synchronous write mode -p, --protect protect existing files -q, --quiet quiet, no progress reports -r, --resume try to resume interrupted file transfer (Z) -R, --restricted restricted, more secure mode -s, --stop-at {HH:MM|+N} stop transmission at HH:MM or in N seconds -S, --timesync request remote time (twice: set local time) --syslog[=off] turn syslog on or off, if possible -t, --timeout N set timeout to N tenths of a second -u, --keep-uppercase keep upper case filenames -U, --unrestrict disable restricted mode (if allowed to) -v, --verbose be verbose, provide debugging information -w, --windowsize N Window is N bytes (Z) -X --xmodem use XMODEM protocol -y, --overwrite Yes, clobber existing file if any --ymodem use YMODEM protocol -Z, --zmodem use ZMODEM protocol short options use the same arguments as the long ones %s waiting to receive. Bytes received: %7ld/%7ld BPS:%-6ld %s/%s: %ld Bytes, %ld BPS%s: ready to receive %sw%s/%s: cannot open: %m Bytes received: %7ld BPS:%-6ld no.name%s/%s: got error %s: %s removed. ?Pathname fetch returned EOTReceived dup SectorSync ErrorCRCChecksumSector number garbledSender CancelledTIMEOUTGot 0%o sector headercannot fstat open file: %sgot ZCANfile name ends with a /, skipped: %s file name ends with a /, skipped: %szmanag=%d, Lzmanag=%d zconv=%d ar+$time$.t$tcp$.t%ld%lo%orfile exists, skipped: %s cannot fstat open file %s: %sskipping %s: newer file existsskipping %s: longer+newer file exists%dTIMESYNC: here %ld, remote %ld, diff %ld seconds TIMESYNC: cannot set time: %s cannot tmpfile() for tcp protocol synchronization%s %sBINASCIITopipe%s: %s %s Receiving: %s /dev/nullcannot open %s%s: cannot open: %sMade directory %s Blocks received: %d%s: %s exists ../%s: Security Violation/.remote command execution requestednot executedrexec denied: %srexec allowed: %sgot ZRINITPPPPPPPPPPPPSkipped%s/%s: skipped%s/%s: error?%s/%s: procheader errorusing saved out-of-sync-paket %lx, len %ldremoving unneeded saved out-of-sync-paket %lx, len %ld%s/%s: error: zgethdr returned %drzfile: zgethdr returned %dZNAK%s/%s: error: zgethdr returned %s%s/%s: error: closeit return <>0rzfile: closeit returned <> 0rzfile: normal EOF%s/%s: error: sender skippedrzfile: Sender SKIPPED filerzfile: out of sync%s/%s: error: out of syncsaving out-of-sync-block %lx, len %lurzfile: bps rate %ld below min %ld%s/%s: bps rate low: %ld < %ldrzfile: reached stop time%s/%s: reached stop time Bytes received: %7ld/%7ld BPS:%-6ld ETA %02d:%02d rzfile: zrdata returned %d%s/%s: zrdata returned ZCAN%s/%s: zrdata returned ERROR%s/%s: zrdata returned TIMEOUT?%`Cfgets for tcp protocol synchronization failed: file close errorackbibi:ackbibi complete-csh/bin/shexecl.ARetry %d: %s: : %s Calling read: alarm=%d Readnum=%d Calling read: Readnum=%d Read returned %d bytes errno=%d:%s %02x out of memorymode:%dxxxxxZSTDERRZCOMMANDZFREECNTZCANZCOMPLZCHALLENGEZCRCZFERRZEOFZDATAZRPOSZFINZABORTZNAKZSKIPZFILEZACKZSINITZRINITZRQINITERRORTIMEOUTCarrier Lostzgethex: %02XBad escape sequence %xzsbhdr: %s %lxzshhdr: %s %lxZCRCWZCRCQZCRCGZCRCEzsdata: %lu %szsdat32: %d %sBad CRCzrdata: %lu %sSender CanceledBad data subpacketData subpacket too longzrdat32: %lu %sGarbage count exceededGot %szgethdr: %s %lxzgethdr: %d %lxq``q``` ` ````qppbPPbPPPPPPPPb2  2        2``@@2  2        200zputhex: %02XXMODEMYMODEMZMODEMsocketsetsockopt (reuse address)bindgetsockname[%s] <%d> listenaccepttcp_connect: illegal format1 tcp_connect: illegal format2 tcp_connect: illegal format3 tcp_connect: illegal format4 tcp_connect: illegal format5 connect#%lu[%s] %sEhEvversionhelp+_AOA@A | @`%s: : %s%s:%s:%d: _`  xx!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-n,X `  % KKd@@@@@@@@@@@@}@w@r@l@g@\@U@P@G@>@6@0@+A%AAA0123456789abcdefaZjzʔڔ *:JZjzʕڕ *:JZjzʖږ *:JZjzʗڗ *:JZjzʘژ *:JZjzʙڙ *:JZ  (tt  _ ̐@ooo.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.sbss.bss# 1((L7 tt?tt 7GoTo@c ̐l Ԑ8u    ~/DD ppl ܠ!% V ____a4b@@b@# @